DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krimp and tapas

DIOPT Version :9

Sequence 1:NP_611103.2 Gene:krimp / 36804 FlyBaseID:FBgn0034098 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_611475.3 Gene:tapas / 37304 FlyBaseID:FBgn0027529 Length:1222 Species:Drosophila melanogaster


Alignment Length:208 Identity:42/208 - (20%)
Similarity:76/208 - (36%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 IYNQILKDMAAFPENTIVTAVLASVDVTDNCAYVAKWDESSDRIKKVLQRQLPLQELDQLPDYGD 367
            ::.:::..:|.|.|.|               .::.:..||....:||.:.......|.::||.. 
  Fly   573 VWARMIDQIANFEELT---------------KHIGRQMESPHFRQKVSKPYAQEVYLVEMPDGW- 621

  Fly   368 IFAVLDSINNIITRITINSSSAGGGYDAYLIDFGEHIHFDGNETIFKLPDDIKRLPAQAIRCDLI 432
                     |.:..|:::..:..|.|  :.||||:...|. :|.:|..|.....|||||:...:.
  Fly   622 ---------NRVRAISVDEETRSGRY--HFIDFGDVAMFH-SEDLFHCPPQFLALPAQAVCLSMY 674

  Fly   433 NCDIANMHCFVNTYIKIRVHENNNSTLV----------------AEPVIDRLSRPTKTNTTKYPA 481
            ..|....|...   :::...|.:..|:|                |:.|::...|......|.|..
  Fly   675 ALDKFEDHPHA---LQVLTKELDGQTVVAHVLTTEKQFLELGGSAQGVVENGKRRACLVATLYDT 736

  Fly   482 GITEDDMAMLNEI 494
            ...||  ..||::
  Fly   737 STAED--IHLNDL 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krimpNP_611103.2 TUDOR 568..679 CDD:278965
TUDOR 618..662 CDD:119391
tapasNP_611475.3 LOTUS_TDRD_OSKAR 7..92 CDD:193586
TUDOR 563..673 CDD:278965 28/127 (22%)
TUDOR 766..896 CDD:278965
TUDOR 1032..1151 CDD:278965
TUDOR 1087..1131 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.