DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krimp and papi

DIOPT Version :9

Sequence 1:NP_611103.2 Gene:krimp / 36804 FlyBaseID:FBgn0034098 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_608657.1 Gene:papi / 33401 FlyBaseID:FBgn0031401 Length:576 Species:Drosophila melanogaster


Alignment Length:145 Identity:34/145 - (23%)
Similarity:68/145 - (46%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 PTEVYGQFLDGSPPLVWDKKDVPENKR---------TFKSK-----------PRLLDIVLALYS- 625
            |.|||...: .||...|.:...|::|:         ::.|.           |.:..||.|::. 
  Fly   260 PMEVYVSAV-ASPTKFWVQLIGPQSKKLDSMVQEMTSYYSSAENRAKHVLTAPYVGQIVAAVFKF 323

  Fly   626 DGCFYRAQIIDEFPSEYM-------IFYVDYGNTEFVPLSCLAPCE-NVD----SFKPHRVFSFH 678
            |..:|||:|:|..|::|.       :::||||::|::..:.:  || ..|    .|:....|..:
  Fly   324 DEKWYRAEIVDIMPNQYNPKEQVIDLYFVDYGDSEYISPADI--CELRTDFLTLRFQAVECFLAN 386

  Fly   679 IEGIVRSKNLTHQKT 693
            ::..::::.:|..|:
  Fly   387 VKSTIQTEPITWPKS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krimpNP_611103.2 TUDOR 568..679 CDD:278965 32/129 (25%)
TUDOR 618..662 CDD:119391 16/51 (31%)
papiNP_608657.1 KH-I 68..127 CDD:238053
KH_1 138..201 CDD:306517
TUDOR 257..386 CDD:306940 32/128 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.