DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and TEF

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_003207.1 Gene:TEF / 7008 HGNCID:11722 Length:303 Species:Homo sapiens


Alignment Length:206 Identity:65/206 - (31%)
Similarity:91/206 - (44%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PILDVT---ETVSMHSE---LDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFE 66
            ||.|.|   :..|.|.|   ||..|.....|:....:..||.|......|...|..|:.:.|:..
Human    81 PIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAELEGKESASSSTASPPSSS 145

  Fly    67 -YIAPPSHALQALEFPL-------------------------MELNRVGVIGGGMFPGFVHRRVR 105
             .|..||..:.:.|..|                         .:|....|.||.:|....|:...
Human   146 TAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE 210

  Fly   106 GEKRP-----------IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSIL 159
            .:.:|           :|:.|||.||:.|||:||.|||||||||:::|::|..|||.||:||:.|
Human   211 EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTAL 275

  Fly   160 RAQVLALRDEL 170
            |.:|..||.|:
Human   276 RTEVAELRKEV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/55 (60%)
coiled coil 117..175 CDD:269843 32/54 (59%)
TEFNP_003207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..176 8/43 (19%)
bZIP_HLF 232..290 CDD:269843 33/55 (60%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 235..255 15/19 (79%)
coiled coil 236..287 CDD:269843 30/51 (59%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 256..263 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.700

Return to query results.
Submit another query.