DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Hlf

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_006247198.1 Gene:Hlf / 690286 RGDID:1582828 Length:296 Species:Rattus norvegicus


Alignment Length:195 Identity:56/195 - (28%)
Similarity:87/195 - (44%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HSPAQSPILDVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPG-MIGAKRSSETLPAF 65
            |||....:...:.|.....:|.:...:..:|             |:..|. |....|..:.|||.
  Rat   106 HSPHPPGLQPASSTAPSVMDLSSRATAPLHP-------------GIPSPNCMQNPIRPGQLLPAN 157

  Fly    66 EYIAPPSHALQALEFPL------MELNRVGVIGGGMFPGFVHRRVRGEKRPIP------------ 112
            .....|... ..::.|:      .:|....:.|..||.....:....|.:|.|            
  Rat   158 RNTPSPIDP-DTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPD 221

  Fly   113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            :.::|.||:.||::||.|||||||||:::|::||.||:.||:|||.||.:|..||.||...:.:|
  Rat   222 DLKQDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNIL 286

  Fly   178  177
              Rat   287  286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/58 (57%)
coiled coil 117..175 CDD:269843 33/57 (58%)
HlfXP_006247198.1 bZIP_HLF 226..284 CDD:269843 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.