DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and ddit3

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005166228.1 Gene:ddit3 / 561924 ZFINID:ZDB-GENE-070410-90 Length:242 Species:Danio rerio


Alignment Length:192 Identity:39/192 - (20%)
Similarity:66/192 - (34%) Gaps:46/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SKNNPSYSISIPQNLRLTGLGFPGMI---GAKRSSETLPAFEYIAPPSHALQALE-------FP- 81
            |:..|.: :.:.::..||.| ..|.:   |.:|.:|..|..:  :||....:..|       .| 
Zfish    46 SEKEPEF-LDVLESCSLTWL-TEGQVWGDGVQRVTEDPPVHQ--SPPRQEERTTENTSSGDLLPP 106

  Fly    82 -LMELNRVGVIGGGMFPGFVHRRVRGEKRPI----------------------------PEAQKD 117
             ..||...|.:|..|..|.....:.....|.                            |.|...
Zfish   107 EFFELLSEGGVGDTMVNGGAGYHLHAPPSPAASEEEELPTVPDTSSCSSASRSPSLNCSPPASPP 171

  Fly   118 AKYFERRKRNNE--AAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            .....:|||...  :|...:.:|:.||.....:...|..:|..|:|::..|.:|:|..|:.|
Zfish   172 VSSSRKRKRGGALCSASPGKKSRREREQENERKVQELTDQNERLKAEIERLGEEVQRTRRAL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 14/60 (23%)
coiled coil 117..175 CDD:269843 14/59 (24%)
ddit3XP_005166228.1 bZIP <204..235 CDD:304365 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.