DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and tefb

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001018497.1 Gene:tefb / 553686 ZFINID:ZDB-GENE-050522-224 Length:284 Species:Danio rerio


Alignment Length:178 Identity:58/178 - (32%)
Similarity:87/178 - (48%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHAL 75
            |::::.:...||..|..::  ||   |:|:  |.|    |..:    |.|.:.......|....|
Zfish   122 DLSDSQTAEQELSEETTAE--PS---SVPE--RAT----PSPV----SPEDIEVNVSFQPDPTDL 171

  Fly    76 QALEFPLMELNRVGVIGGGMFPGFVHRRVRGEKRP-----------IPEAQKDAKYFERRKRNNE 129
            .....|          ||.:|....||....|.:|           :||..||.||:.|||:||.
Zfish   172 VLSSVP----------GGELFNPRKHRFSEDELKPQPMIKKAKKVFVPEDAKDDKYWSRRKKNNV 226

  Fly   130 AAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            |||||||||:::|::||.||:.||:||:.||.||..||.:....::::
Zfish   227 AAKRSRDARRLKENQIAVRASFLERENAALRQQVAELRKDCGRCQKIM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/58 (57%)
coiled coil 117..175 CDD:269843 32/57 (56%)
tefbNP_001018497.1 bZIP_HLF 213..265 CDD:269843 32/51 (63%)
coiled coil 214..265 CDD:269843 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.