DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and tef

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001017319.1 Gene:tef / 550073 XenbaseID:XB-GENE-962732 Length:296 Species:Xenopus tropicalis


Alignment Length:193 Identity:64/193 - (33%)
Similarity:93/193 - (48%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QSPILDVTETVSMHSELDAELESKNNP-SYSISIPQNLRLTGLGFPGMIGAK--------RSSET 61
            |:|::.|           :||||.:.| |.|.:.|.:        |.::..|        ::.|.
 Frog   109 QNPLVPV-----------SELESDSEPASTSAASPLS--------PSVLLQKSEVKDSDSKAEED 154

  Fly    62 LPAFEYIAPPSHALQALEFP-LMELNRVGVIGGGMFPGFVHRRVRGEKRP-----------IPEA 114
            .|:  .|.|....:|....| ..:|....|.|..:|....||....|.:|           :||.
 Frog   155 PPS--PIDPEKVEIQVNFNPDPSDLLLSTVPGEELFDPRKHRFAEEELKPQPMIKKAKKIYVPED 217

  Fly   115 QKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            .||.||:.||.:||.|||||||||:::|::|..|||.||:|||.||::|..||.||...|.::
 Frog   218 LKDEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSALRSEVADLRKELSKCRNII 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 34/58 (59%)
coiled coil 117..175 CDD:269843 33/57 (58%)
tefNP_001017319.1 T4BSS_DotH_IcmK 132..>184 CDD:289093 11/61 (18%)
bZIP_HLF 219..278 CDD:269843 34/58 (59%)
coiled coil 220..278 CDD:269843 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.