DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Ddit3

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001103456.1 Gene:Ddit3 / 29467 RGDID:62391 Length:168 Species:Rattus norvegicus


Alignment Length:159 Identity:37/159 - (23%)
Similarity:62/159 - (38%) Gaps:41/159 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SSETLP-AFEYIAPPSHALQALEFPLMELNRVGVIGGGMF--PGFVHRRVRG------------E 107
            ::|:|| |||.::  |..|:|....|.|:.....|||...  ||......:.            .
  Rat     2 AAESLPFAFETVS--SWELEAWYEDLQEVLSSDEIGGTYISSPGNEEEESKTFTTLDPASLAWLT 64

  Fly   108 KRPIP-----------------------EAQKDAKYFERRKRNNEAAKRSRDAR-KIREDRIAFR 148
            :.|.|                       |.::|.....:||::.:.|.|:...| |.:|.....:
  Rat    65 EEPGPAEVTSTSQSPRSPDSSQSSMAQEEEEEDQGRTRKRKQSGQCAARAGKQRMKEKEQENERK 129

  Fly   149 AALLEQENSILRAQVLALRDELQTVRQLL 177
            .|.|.:||..|:.::..|..|::|.|:.|
  Rat   130 VAQLAEENERLKQEIERLTREVETTRRAL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 16/59 (27%)
coiled coil 117..175 CDD:269843 16/58 (28%)
Ddit3NP_001103456.1 N-terminal. /evidence=ECO:0000250 10..26 5/17 (29%)
Interaction with TRIB3. /evidence=ECO:0000250 10..18 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..130 16/95 (17%)
coiled coil 98..152 CDD:269834 14/53 (26%)
BRLZ 100..160 CDD:197664 17/59 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 100..129 7/28 (25%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..147 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.