DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Tef

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_062067.2 Gene:Tef / 29362 RGDID:3841 Length:301 Species:Rattus norvegicus


Alignment Length:206 Identity:66/206 - (32%)
Similarity:92/206 - (44%) Gaps:43/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PILDVT---ETVSMHSE---LDAELESKNNPSYSISIPQNLRLTGLGFPGMIGAKRSSETLPAFE 66
            ||.|.|   :..|.|.|   ||..|.....|:....:.|||.|......|...|..|:.:.|:..
  Rat    79 PIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAQNLLLPVAELEGKESASSSTASPPSSS 143

  Fly    67 -YIAPPSHALQALEFPL-------------------------MELNRVGVIGGGMFPGFVHRRVR 105
             .|..||..:.:.|..|                         .:|....|.||.:|....|:...
  Rat   144 TAIFQPSETVSSTESSLEKERETPSPIDPNCVEVDVNFNPDPADLVLSSVPGGELFNPRKHKFAE 208

  Fly   106 GEKRP-----------IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSIL 159
            .:.:|           :|:.|||.||:.|||:||.|||||||||:::|::|..|||.||:||:.|
  Rat   209 EDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTAL 273

  Fly   160 RAQVLALRDEL 170
            |.:|..||.|:
  Rat   274 RTEVAELRKEV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 33/55 (60%)
coiled coil 117..175 CDD:269843 32/54 (59%)
TefNP_062067.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..174 8/43 (19%)
bZIP_HLF 230..288 CDD:269843 33/55 (60%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 233..253 15/19 (79%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 254..261 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345402
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.