DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Cebpd

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_037286.1 Gene:Cebpd / 25695 RGDID:2328 Length:268 Species:Rattus norvegicus


Alignment Length:195 Identity:54/195 - (27%)
Similarity:80/195 - (41%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPAQSPILDVTETVSMHSELDAELESKNNPSY---SISIPQN--LRLTGLGFPGMIGAKRSSE-- 60
            |.|..|.|::     .|.|:.|:|.:.|:.:.   |:.:.|.  .|..|:|.......||..:  
  Rat    67 SMAAVPTLEL-----CHDEIFADLFNSNHKAAGAGSLELLQGGPTRPPGVGSIARGPLKREPDWG 126

  Fly    61 -------TLPA-----FEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRR---VRGEKRP 110
                   .|||     .:.:...:.|.|.......|..| |..|..:.||.|..:   .||..|.
  Rat   127 DGDAPGSLLPAQVAVCAQTVVSLAAAAQPTPPTSPEPPR-GSPGPSLAPGPVREKGAGKRGPDRG 190

  Fly   111 IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQ 175
            .||      |.:||:|||.|.::|||..|.|...:..:...|..||..|..:|..|..:|.::||
  Rat   191 SPE------YRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLASLRQ 249

  Fly   176  175
              Rat   250  249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 19/58 (33%)
coiled coil 117..175 CDD:269843 19/57 (33%)
CebpdNP_037286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..132 6/33 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..223 26/77 (34%)
bZIP_CEBPD 188..252 CDD:269862 24/68 (35%)
coiled coil 191..249 CDD:269862 21/63 (33%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 11/26 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.