Sequence 1: | NP_611101.1 | Gene: | CG7786 / 36802 | FlyBaseID: | FBgn0034096 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037286.1 | Gene: | Cebpd / 25695 | RGDID: | 2328 | Length: | 268 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 54/195 - (27%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 34/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 SPAQSPILDVTETVSMHSELDAELESKNNPSY---SISIPQN--LRLTGLGFPGMIGAKRSSE-- 60
Fly 61 -------TLPA-----FEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRR---VRGEKRP 110
Fly 111 IPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQ 175
Fly 176 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7786 | NP_611101.1 | bZIP_HLF | 116..175 | CDD:269843 | 19/58 (33%) |
coiled coil | 117..175 | CDD:269843 | 19/57 (33%) | ||
Cebpd | NP_037286.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..50 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 98..132 | 6/33 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 152..223 | 26/77 (34%) | |||
bZIP_CEBPD | 188..252 | CDD:269862 | 24/68 (35%) | ||
coiled coil | 191..249 | CDD:269862 | 21/63 (33%) | ||
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 195..222 | 11/26 (42%) | |||
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 226..254 | 9/24 (38%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |