DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Dbp

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_036675.1 Gene:Dbp / 24309 RGDID:2491 Length:325 Species:Rattus norvegicus


Alignment Length:190 Identity:59/190 - (31%)
Similarity:91/190 - (47%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HSPAQSPILDVTETVSMHSELDAELESKNNPS----YSISI-------PQNLRLTGLGFPGMIGA 55
            |:||::       |:.......|.|.|::.||    .::.:       |.:|.|:          
  Rat   168 HAPARA-------TLGAAGGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALS---------- 215

  Fly    56 KRSSETLPAFEYIAPPSHALQALEF---PLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKD 117
                 ::|..|...|..|.....|.   |:|:                    :..|..:||.|||
  Rat   216 -----SIPGHETFDPRRHRFSEEELKPQPIMK--------------------KARKVQVPEEQKD 255

  Fly   118 AKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            .||:.||.:||||||||||||:::|::|:.|||.||:||::||.:|:|:|.||...|.:|
  Rat   256 EKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 34/58 (59%)
coiled coil 117..175 CDD:269843 33/57 (58%)
DbpNP_036675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..203 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..255 7/44 (16%)
bZIP_HLF 254..313 CDD:269843 34/58 (59%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 16/21 (76%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 8/13 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.