DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and cebp-1

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_508276.2 Gene:cebp-1 / 180481 WormBaseID:WBGene00016997 Length:319 Species:Caenorhabditis elegans


Alignment Length:82 Identity:25/82 - (30%)
Similarity:41/82 - (50%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSR-------DARKIREDRIAFRAALLEQENSILR 160
            |.|..|....|.:.:..|..:|.|||:|.::||       |.::...|::..|.|.||   .:|:
 Worm   219 RARKYKLKADEEKAEPTYKLKRARNNDAVRKSRKKAKELQDKKEAEHDKMKRRIAELE---GLLQ 280

  Fly   161 AQVLALRDELQTVRQLL 177
            ::..|.|.:..|:.|||
 Worm   281 SERDARRRDQDTLEQLL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 18/65 (28%)
coiled coil 117..175 CDD:269843 18/64 (28%)
cebp-1NP_508276.2 bZIP 233..280 CDD:304365 14/49 (29%)
coiled coil 236..280 CDD:269834 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.