DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and atf-8

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_504576.1 Gene:atf-8 / 178998 WormBaseID:WBGene00017535 Length:241 Species:Caenorhabditis elegans


Alignment Length:77 Identity:36/77 - (46%)
Similarity:52/77 - (67%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRD 168
            ||.|.:...:..||..|:|||::||:|||||||.|:::||.:|.||..||:||.:||.::..||.
 Worm   103 VRNELKRKKDQVKDVAYWERRRKNNDAAKRSRDQRRMKEDEMAHRATSLERENMLLRVELDQLRA 167

  Fly   169 ELQTVRQLLGAT 180
            |...:|.|:..|
 Worm   168 ETDKLRALILTT 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 30/58 (52%)
coiled coil 117..175 CDD:269843 29/57 (51%)
atf-8NP_504576.1 bZIP_HLF 115..174 CDD:269843 30/58 (52%)
coiled coil 119..170 CDD:269843 28/50 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm14350
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.