powered by:
Protein Alignment CG7786 and zip-8
DIOPT Version :9
Sequence 1: | NP_611101.1 |
Gene: | CG7786 / 36802 |
FlyBaseID: | FBgn0034096 |
Length: | 192 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498426.1 |
Gene: | zip-8 / 175924 |
WormBaseID: | WBGene00017755 |
Length: | 176 |
Species: | Caenorhabditis elegans |
Alignment Length: | 62 |
Identity: | 23/62 - (37%) |
Similarity: | 38/62 - (61%) |
Gaps: | 7/62 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVR 174
:.::..||.|:|.:||||||:||.:||.||.: .:.||.:|:.:..||.:||:..:
Worm 61 DPKRSPKYLEKRMKNNEAAKKSRASRKHREQK-------NQTENELLKRKNAALEEELKQAK 115
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.