DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and zip-8

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_498426.1 Gene:zip-8 / 175924 WormBaseID:WBGene00017755 Length:176 Species:Caenorhabditis elegans


Alignment Length:62 Identity:23/62 - (37%)
Similarity:38/62 - (61%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVR 174
            :.::..||.|:|.:||||||:||.:||.||.:       .:.||.:|:.:..||.:||:..:
 Worm    61 DPKRSPKYLEKRMKNNEAAKKSRASRKHREQK-------NQTENELLKRKNAALEEELKQAK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 23/59 (39%)
coiled coil 117..175 CDD:269843 23/58 (40%)
zip-8NP_498426.1 bZIP_BmCbz-like 68..119 CDD:269875 22/55 (40%)
coiled coil 68..119 CDD:269875 22/55 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.