DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and ces-2

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_493610.1 Gene:ces-2 / 173365 WormBaseID:WBGene00000469 Length:211 Species:Caenorhabditis elegans


Alignment Length:158 Identity:54/158 - (34%)
Similarity:74/158 - (46%) Gaps:26/158 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LTGLGFP-------------GMIGAKRSS--------ETLPAFEYIAPPSHALQALEFPLME--- 84
            |..||||             ...|.|:..        ::||....:.|....  .||..|..   
 Worm    21 LGSLGFPFNDGTSILTTALAAQSGGKKLDTPLGILPFDSLPTTNLLTPTKKI--KLEDELCASPV 83

  Fly    85 LNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRA 149
            .:|...:....|........|....||||.:||:.|||||::||:|||||||||:.:|::||.:|
 Worm    84 SSRSSTVSSSHFSSPQRSPSRKMSVPIPEEKKDSAYFERRRKNNDAAKRSRDARRQKEEQIASKA 148

  Fly   150 ALLEQENSILRAQVLALRDELQTVRQLL 177
            ..||:||..||.:|.:|..|...:|.||
 Worm   149 HALERENMQLRGKVSSLEQEAAQLRFLL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 31/58 (53%)
coiled coil 117..175 CDD:269843 30/57 (53%)
ces-2NP_493610.1 bZIP_HLF 115..173 CDD:269843 31/57 (54%)
coiled coil 116..173 CDD:269843 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm14350
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.