DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and DDIT3

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001181982.1 Gene:DDIT3 / 1649 HGNCID:2726 Length:192 Species:Homo sapiens


Alignment Length:66 Identity:16/66 - (24%)
Similarity:33/66 - (50%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EAQKDAKYFERRKRNNEA-AKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            |.::|.....:||::..: |:..:...|.:|.....:.|.|.:||..|:.::..|..|::..|:.
Human   117 EEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRA 181

  Fly   177 L 177
            |
Human   182 L 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 13/59 (22%)
coiled coil 117..175 CDD:269843 13/58 (22%)
DDIT3NP_001181982.1 BRLZ 119..182 CDD:197664 14/62 (23%)
coiled coil 122..176 CDD:269834 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.