DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and DDIT3

DIOPT Version :10

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001181982.1 Gene:DDIT3 / 1649 HGNCID:2726 Length:192 Species:Homo sapiens


Alignment Length:66 Identity:16/66 - (24%)
Similarity:33/66 - (50%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EAQKDAKYFERRKRNNEA-AKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            |.::|.....:||::..: |:..:...|.:|.....:.|.|.:||..|:.::..|..|::..|:.
Human   117 EEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRA 181

  Fly   177 L 177
            |
Human   182 L 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 13/59 (22%)
coiled coil 117..175 CDD:269843 13/58 (22%)
DDIT3NP_001181982.1 BRLZ 119..182 CDD:197664 14/62 (23%)
coiled coil 125..176 CDD:269834 12/50 (24%)

Return to query results.
Submit another query.