DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and DBP

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001343.2 Gene:DBP / 1628 HGNCID:2697 Length:325 Species:Homo sapiens


Alignment Length:189 Identity:61/189 - (32%)
Similarity:90/189 - (47%) Gaps:52/189 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPAQSPILDVTETVSMHSELDAELESKNNPS----YSISI-------PQNLRLTGLGFPGMIGAK 56
            ||..:|......|.|.|.   |.|.|::.||    .::.:       |.:|.|:           
Human   165 SPGHAPARAALGTASGHR---AGLTSRDTPSPVDPDTVEVLMTFEPDPADLALS----------- 215

  Fly    57 RSSETLPAFEYIAPPSHALQALEF---PLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDA 118
                ::|..|...|..|.....|.   |:|:                    :..|..:||.|||.
Human   216 ----SIPGHETFDPRRHRFSEEELKPQPIMK--------------------KARKIQVPEEQKDE 256

  Fly   119 KYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            ||:.||.:||||||||||||:::|::|:.|||.||:||::||.:|:|:|.||...|.:|
Human   257 KYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYRAVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 34/58 (59%)
coiled coil 117..175 CDD:269843 33/57 (58%)
DBPNP_001343.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..200 11/37 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..255 7/45 (16%)
bZIP_HLF 254..313 CDD:269843 34/58 (59%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 16/21 (76%)
coiled coil 258..309 CDD:269843 30/50 (60%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 8/13 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.