DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and Cebpa

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001274443.1 Gene:Cebpa / 12606 MGIID:99480 Length:396 Species:Mus musculus


Alignment Length:137 Identity:39/137 - (28%)
Similarity:55/137 - (40%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHR 102
            :|.......||..|:.|                |..||:.|.....:| |.|..|||...|    
Mouse   265 VPSPHAAPALGAAGLPG----------------PGSALKGLAGAHPDL-RTGGGGGGSGAG---- 308

  Fly   103 RVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALR 167
              .|:.:...:...: :|..||:|||.|.::|||..|.|......:...|..:|..||.:|..|.
Mouse   309 --AGKAKKSVDKNSN-EYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS 370

  Fly   168 DELQTVR 174
            .||.|:|
Mouse   371 RELDTLR 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 22/59 (37%)
coiled coil 117..175 CDD:269843 22/58 (38%)
CebpaNP_001274443.1 bZIP_CEBPA 318..378 CDD:269859 22/61 (36%)
coiled coil 320..378 CDD:269859 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.