DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and cebp1

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_571912.1 Gene:cebp1 / 114453 ZFINID:ZDB-GENE-010611-1 Length:169 Species:Danio rerio


Alignment Length:185 Identity:43/185 - (23%)
Similarity:74/185 - (40%) Gaps:54/185 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPAQSPILDV--TETVSMHSELDAEL------ESKNNPSYSI--SIPQNLRLTGLGFPGMIGAKR 57
            |.||:|:...  |:|:|.....:..:      ...|||:.:.  |:.|:                
Zfish    17 SSAQTPMDSALYTQTISFTKSPEVMMGYLPYSSCLNNPNTNTERSVQQS---------------- 65

  Fly    58 SSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDAKYFE 122
            |:.|....:::.||         |...|                 |:..:||.:  ::..|:|.:
Zfish    66 SAHTQDFAQFLEPP---------PASAL-----------------RLCAQKRGV--SKDSAEYRQ 102

  Fly   123 RRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            ||:|||.|.::|||..:.|......||..|:.||..|:..:..|..|::.:|..|
Zfish   103 RRERNNIAVRKSRDKARRRIQMTQQRALQLQDENHRLQVHIQRLLHEVEALRHYL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 20/58 (34%)
coiled coil 117..175 CDD:269843 20/57 (35%)
cebp1NP_571912.1 bZIP_CEBP 96..155 CDD:269841 20/58 (34%)
coiled coil 97..155 CDD:269841 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.