DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and CEBPE

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:119 Identity:37/119 - (31%)
Similarity:55/119 - (46%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IAPPSHALQALEFPL-------MELNRVGVIGGGMFPGFVHRRVRGEKRPIPEAQKDA-KYFERR 124
            :|.|...|:.|:.||       ..|.:.....|.:..|         |:.:   .||: :|..||
Human   159 LAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKG---------KKAV---NKDSLEYRLRR 211

  Fly   125 KRNNEAAKRSRDARKIREDRIAFRAALLE--QENSILRAQVLALRDELQTVRQL 176
            :|||.|.::|||..|.|  .:..:..:||  .||..||::|..|..||.|:|.|
Human   212 ERNNIAVRKSRDKAKRR--ILETQQKVLEYMAENERLRSRVEQLTQELDTLRNL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 25/61 (41%)
coiled coil 117..175 CDD:269843 24/60 (40%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021 7/32 (22%)
bZIP_CEBPE 202..262 CDD:269863 25/61 (41%)
coiled coil 207..258 CDD:269863 21/52 (40%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 10/19 (53%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.