DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7786 and CEBPD

DIOPT Version :9

Sequence 1:	NP_611101.1	Gene:	CG7786 / 36802	FlyBaseID:	FBgn0034096	Length:	192	Species:	Drosophila melanogaster
Sequence 2:	NP_005186.2	Gene:	CEBPD / 1052	HGNCID:	1835	Length:	269	Species:	Homo sapiens

Alignment Length:	71	Identity:	26/71 - (36%)
Similarity:	35/71 - (49%)	Gaps:	6/71 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 RGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDE 169
            ||..|..||      |.:||:|||.|.::|||..|.|...:..:...|..||..|..:|..|..:
Human   185 RGPDRGSPE------YRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRD 243

  Fly   170 LQTVRQ 175
            |..:||
Human   244 LAGLRQ 249

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7786	NP_611101.1	bZIP_HLF	116..175	CDD:269843	19/58 (33%)
CG7786	NP_611101.1	coiled coil	117..175	CDD:269843	19/57 (33%)
CEBPD	NP_005186.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..48
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	97..133
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	151..219		17/39 (44%)
		bZIP_CEBPD	188..252	CDD:269862	24/68 (35%)
		coiled coil	191..249	CDD:269862	21/63 (33%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	195..222		11/26 (42%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	226..254		9/24 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810