DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7786 and CEBPB

DIOPT Version :9

Sequence 1:	NP_611101.1	Gene:	CG7786 / 36802	FlyBaseID:	FBgn0034096	Length:	192	Species:	Drosophila melanogaster
Sequence 2:	NP_005185.2	Gene:	CEBPB / 1051	HGNCID:	1834	Length:	345	Species:	Homo sapiens

Alignment Length:	74	Identity:	25/74 - (33%)
Similarity:	39/74 - (52%)	Gaps:	1/74 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   103 RVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALR 167
            :|:.:.:...:...| :|..||:|||.|.::|||..|:|......:...|..||..|:.:|..|.
Human   258 QVKSKAKKTVDKHSD-EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLS 321

  Fly   168 DELQTVRQL 176
            .||.|:|.|
Human   322 RELSTLRNL 330

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7786	NP_611101.1	bZIP_HLF	116..175	CDD:269843	22/58 (38%)
CG7786	NP_611101.1	coiled coil	117..175	CDD:269843	22/57 (39%)
CEBPB	NP_005185.2	Required for Lys-174 sumoylation	1..24
		Required for MYC transcriptional repression. /evidence=ECO:0000250\|UniProtKB:P28033	24..135
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	46..67
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	79..116
		9aaTAD	116..124
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..178
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	218..271		1/12 (8%)
		bZIP_CEBPB	264..334	CDD:269860	24/68 (35%)
		coiled coil	271..332	CDD:269860	24/61 (39%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	275..295		10/19 (53%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	297..304		0/6 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810