powered by:
Protein Alignment CG7786 and CEBPB
DIOPT Version :9
Sequence 1: | NP_611101.1 |
Gene: | CG7786 / 36802 |
FlyBaseID: | FBgn0034096 |
Length: | 192 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_005185.2 |
Gene: | CEBPB / 1051 |
HGNCID: | 1834 |
Length: | 345 |
Species: | Homo sapiens |
Alignment Length: | 74 |
Identity: | 25/74 - (33%) |
Similarity: | 39/74 - (52%) |
Gaps: | 1/74 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 RVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALR 167
:|:.:.:...:...| :|..||:|||.|.::|||..|:|......:...|..||..|:.:|..|.
Human 258 QVKSKAKKTVDKHSD-EYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLS 321
Fly 168 DELQTVRQL 176
.||.|:|.|
Human 322 RELSTLRNL 330
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3119 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.