DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and CEBPA

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001274353.1 Gene:CEBPA / 1050 HGNCID:1833 Length:393 Species:Homo sapiens


Alignment Length:142 Identity:37/142 - (26%)
Similarity:51/142 - (35%) Gaps:39/142 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IPQNLRLTGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEFPLMELNRVGVIGGGMFPGFVHR 102
            :|.......||..|:.|                |..||:.|.....:|...|..|.|        
Human   267 VPSPHPAPALGAAGLPG----------------PGSALKGLGAAHPDLRASGGSGAG-------- 307

  Fly   103 RVRGEKRPIPEAQKDA-----KYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQ 162
                      :|:|..     :|..||:|||.|.::|||..|.|......:...|..:|..||.:
Human   308 ----------KAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKR 362

  Fly   163 VLALRDELQTVR 174
            |..|..||.|:|
Human   363 VEQLSRELDTLR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 23/64 (36%)
coiled coil 117..175 CDD:269843 22/63 (35%)
CEBPANP_001274353.1 bZIP_CEBPA 315..375 CDD:269859 22/60 (37%)
coiled coil 317..375 CDD:269859 22/58 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.