DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and dbp

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_002938324.1 Gene:dbp / 100494503 XenbaseID:XB-GENE-5995286 Length:311 Species:Xenopus tropicalis


Alignment Length:206 Identity:62/206 - (30%)
Similarity:93/206 - (45%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAQSPILDVTETVS-----------MHSELDAELE------------SKNNP----SYSISIPQN 41
            |:...::|::...|           :.|.:|:|.|            |:::|    |.|:.:..|
 Frog   126 PSNQSVVDLSRPASCASSTSACSSPVQSMIDSEYEHPSSQAGQMTPGSRDSPSPANSESLEVISN 190

  Fly    42 LRL--TGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEF---PLMELNRVGVIGGGMFPGFVH 101
            ..|  |.|..          .::|..|...|..|.....|.   |:|:                 
 Frog   191 FDLDPTDLAL----------SSVPGHETFDPRKHRFSEEELKPQPIMK----------------- 228

  Fly   102 RRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLAL 166
               :..|..:||.|||.||:.||.:||||||||||||:::|::|..|||.||:|||:||.:|..:
 Frog   229 ---KARKIQVPEEQKDEKYWNRRYKNNEAAKRSRDARRLKENQITVRAAFLEKENSVLRQEVAKI 290

  Fly   167 RDELQTVRQLL 177
            |.||...|.:|
 Frog   291 RQELSRYRNIL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 34/58 (59%)
coiled coil 117..175 CDD:269843 33/57 (58%)
dbpXP_002938324.1 Stk19 30..>123 CDD:371090
bZIP_HLF 240..299 CDD:269843 34/58 (59%)
coiled coil 241..299 CDD:269843 33/57 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.