Sequence 1: | NP_611101.1 | Gene: | CG7786 / 36802 | FlyBaseID: | FBgn0034096 | Length: | 192 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002938324.1 | Gene: | dbp / 100494503 | XenbaseID: | XB-GENE-5995286 | Length: | 311 | Species: | Xenopus tropicalis |
Alignment Length: | 206 | Identity: | 62/206 - (30%) |
---|---|---|---|
Similarity: | 93/206 - (45%) | Gaps: | 62/206 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 PAQSPILDVTETVS-----------MHSELDAELE------------SKNNP----SYSISIPQN 41
Fly 42 LRL--TGLGFPGMIGAKRSSETLPAFEYIAPPSHALQALEF---PLMELNRVGVIGGGMFPGFVH 101
Fly 102 RRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLAL 166
Fly 167 RDELQTVRQLL 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7786 | NP_611101.1 | bZIP_HLF | 116..175 | CDD:269843 | 34/58 (59%) |
coiled coil | 117..175 | CDD:269843 | 33/57 (58%) | ||
dbp | XP_002938324.1 | Stk19 | 30..>123 | CDD:371090 | |
bZIP_HLF | 240..299 | CDD:269843 | 34/58 (59%) | ||
coiled coil | 241..299 | CDD:269843 | 33/57 (58%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000980 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |