DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and hlf

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_004918616.1 Gene:hlf / 100489797 XenbaseID:XB-GENE-955698 Length:296 Species:Xenopus tropicalis


Alignment Length:186 Identity:56/186 - (30%)
Similarity:86/186 - (46%) Gaps:52/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHSPAQSPILDVTETVSMHSELDAELESKNNPSYSISI-----PQNLRLTGLGFPGMIGAKRSSE 60
            ||||.: |...:|...:..|.:|.|       |..:::     |.:|.|:               
 Frog   144 MHSPVR-PGQILTANRNTPSPIDPE-------SIQVAVGYEPDPADLALS--------------- 185

  Fly    61 TLPAFEYIAPPSHALQALEF---PLMELNRVGVIGGGMFPGFVHRRVRGEKRPIP-EAQKDAKYF 121
            ::|..|...|........|.   |:::                    :..|..|| :.::|.||:
 Frog   186 SIPGQEMFDPRKRKFSEEELKPQPMIK--------------------KARKVFIPDDLKQDEKYW 230

  Fly   122 ERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSILRAQVLALRDELQTVRQLL 177
            .|||:||.|||||||||:::|::||.||:.||:|||.||.:|..||.||...:.:|
 Frog   231 ARRKKNNLAAKRSRDARRLKENQIAIRASFLEKENSALRMEVADLRKELGKCKNIL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 34/58 (59%)
coiled coil 117..175 CDD:269843 34/57 (60%)
hlfXP_004918616.1 bZIP_HLF 226..284 CDD:269843 34/57 (60%)
coiled coil 226..284 CDD:269843 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.