DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7786 and si:dkey-172o19.2

DIOPT Version :9

Sequence 1:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_005170589.1 Gene:si:dkey-172o19.2 / 100000812 ZFINID:ZDB-GENE-070424-213 Length:329 Species:Danio rerio


Alignment Length:162 Identity:51/162 - (31%)
Similarity:71/162 - (43%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DAELESKNNP-SYSISIPQNLR----LTGLGFPGMIGAKRSSETLP--AFEYIAPPSHALQALEF 80
            ||.|.|.... |.|...|.|||    |||            |.||.  .|.:        |:...
Zfish    12 DACLPSSTGEISVSKDEPGNLRRRLPLTG------------SSTLARRLFHF--------QSYRN 56

  Fly    81 PLMELNRVGVIGGGMFPGFVHRRVRGEKRPI-PEAQKDAKYFERRKRNNEAAKRSRDARKIREDR 144
            ||:...|                   .||.: |..:|||.|:.:||:|||||||||:.|::.:..
Zfish    57 PLITSRR-------------------RKREMTPSEKKDASYWVKRKKNNEAAKRSREKRRLNDFM 102

  Fly   145 IAFRAALLEQENSILRAQVLALRDELQTVRQL 176
            :..:...|.:||:.|||:||:|:..:...|.|
Zfish   103 LEGQLLALSEENAQLRAEVLSLQYHMGIARSL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 25/58 (43%)
coiled coil 117..175 CDD:269843 24/57 (42%)
si:dkey-172o19.2XP_005170589.1 bZIP_NFIL3 74..133 CDD:269842 25/58 (43%)
coiled coil 75..133 CDD:269842 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.