DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsf3 and otomp

DIOPT Version :9

Sequence 1:NP_523759.1 Gene:Tsf3 / 36800 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001038552.1 Gene:otomp / 565818 ZFINID:ZDB-GENE-040709-1 Length:371 Species:Danio rerio


Alignment Length:314 Identity:70/314 - (22%)
Similarity:123/314 - (39%) Gaps:53/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KSNIECVIGVDRLDCVRRIHKGTAHFGVLTSEDLVAARWA-SVEILVASELRSHESHFEYEIVAV 119
            :..:.||.|....||:::|..|||....:.::::..|.:. .:::.|.......:. ..|.:||:
Zfish    53 RGQLVCVRGQSPTDCMKQIKNGTADASTMYADEIYTAGFCYGLDVAVGESYNGVDG-INYYVVAL 116

  Fly   120 VDNHANIHTVHDLRGARLCHPGYGLGNHWTEVLANYFEAAMVSKTCDPEMTVTEDRIASTAKYFG 184
            ....::..::.::.....||||......||..:......:.:|  .|.:.....    :...:||
Zfish   117 ARTSSSDLSLLEMHERSSCHPGMRTTVGWTVPIGFLVNTSQIS--VDVQCNFPH----AVGDFFG 175

  Fly   185 PSCKAGPWVPDPKQDRILKNRYP-SLCEMCYEPDS----C--DQTDKHWGRRGALYCLTSGGGNV 242
            .||.  |.|.||:.|.  |...| :|||.|...::    |  :..::|:|..|||.|:....|:|
Zfish   176 YSCV--PGVKDPEHDP--KGNNPRNLCEACIGDENDRHICANNPRERHFGEAGALRCVAENLGDV 236

  Fly   243 AWARLDDVRSHFGFSGIPAQSNPS--------DFSYLCPDGHLQPLNASQPCVWVAKPWPVVAAR 299
            |:.:...|     |..:..::..|        |...|||||....|...:.|.....|...|..|
Zfish   237 AFVKHTTV-----FDNMQGKNQESWALDLELEDLKLLCPDGSEANLFQHESCHLAVVPTNAVVVR 296

  Fly   300 RSHAAQVQR-----------------LVTGLNHDEPD----SWQNALLSLLETY 332
            .....:|.:                 |.:.:|:.:||    .....||.::.||
Zfish   297 LEDKCRVYKFLERVQNAFGNTTEGFSLFSSVNYGQPDVLFSDSTKKLLRVMGTY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 70/314 (22%)
PBP2_transferrin 369..681 CDD:270247
TR_FER 370..656 CDD:214514
otompNP_001038552.1 TR_FER 27..363 CDD:214514 70/314 (22%)
PBP2_transferrin 27..363 CDD:270247 70/314 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KI0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125278at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11944
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.