DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsf3 and SrpRbeta

DIOPT Version :9

Sequence 1:NP_523759.1 Gene:Tsf3 / 36800 FlyBaseID:FBgn0034094 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001261596.1 Gene:SrpRbeta / 47283 FlyBaseID:FBgn0011509 Length:244 Species:Drosophila melanogaster


Alignment Length:146 Identity:35/146 - (23%)
Similarity:52/146 - (35%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILVGLF-ASFLSISMCVAVQPPDDGKLRVCVVESRGVYRKTPKFCPLLEAKSNIECVIGVDRLDC 70
            ::.|.| |:|.||...|..........|  :|:..|.||...|...|.:.::. ..|..||.:  
  Fly    68 LIHGKFPATFTSIKENVGDYRTGSASAR--LVDIPGHYRVRDKCLELYKHRAK-GIVFVVDSV-- 127

  Fly    71 VRRIHKGTAHFGVLTSEDLV-------AARWASVEIL-------VASELRSHESHFEYEIVAVVD 121
                   |||..:....|.:       |.:..||.:|       .|...:..:|..|.|      
  Fly   128 -------TAHKDIRDVADFLYTILSDSATQPCSVLVLCNKQDQTTAKSAQVIKSLLESE------ 179

  Fly   122 NHANIHTVHDLRGARL 137
                :|||.|.|..:|
  Fly   180 ----LHTVRDTRSRKL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsf3NP_523759.1 PBP2_transferrin 33..368 CDD:270247 28/119 (24%)
PBP2_transferrin 369..681 CDD:270247
TR_FER 370..656 CDD:214514
SrpRbetaNP_001261596.1 SR_beta 49..243 CDD:206691 35/146 (24%)
SRPRB 51..221 CDD:255367 35/146 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11485
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.