DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and 9530003J23Rik

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_084182.2 Gene:9530003J23Rik / 77397 MGIID:1924647 Length:151 Species:Mus musculus


Alignment Length:145 Identity:54/145 - (37%)
Similarity:75/145 - (51%) Gaps:12/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSL------ATGRQVGRCSLARQLYRYGMAYNE---LPDWLCLVEGESSFNTKAINPSNV 62
            |.||||.|      ..|:...||||||.|...|:|..:   |.:|:||.:.||:|||.....:..
Mouse     5 LTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTRFNPE 69

  Fly    63 DGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQ-QGFSAWVAWN 126
            |.|..:|:||||.|:||.......|.:.||:.|:.||..:|..::.|||.|.|. ||..:|..|.
Mouse    70 DQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSWAGWI 134

  Fly   127 NRC--QGVKPNVNHC 139
            ..|  :.:|..:..|
Mouse   135 KHCKNKNLKEYIRGC 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 46/126 (37%)
9530003J23RikNP_084182.2 LYZ1 22..147 CDD:238066 46/124 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844180
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.