DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Spaca3

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:136 Identity:53/136 - (38%)
Similarity:79/136 - (58%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLV--LLTLSLATGRQ--VGRCSLARQLYRYGM----AYNELPDWLCLVEGESSFNTKAINPSN 61
            ||.:  ||:..||:.:.  ..||.||::::.:|:    .|| |.||:||....|.|||.|:: ..
Mouse    19 WLALAYLLSCLLASSKAKVFSRCELAKEMHDFGLDGYRGYN-LADWVCLAYYTSGFNTNAVD-HE 81

  Fly    62 VDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACA-KYIRKQQGFSAWVAW 125
            .|||.:.|:|||:.|.||:.......| |||:.|..||::|::.||.|| |.:::..|...|.||
Mouse    82 ADGSTNNGIFQISSRRWCRTLASNGPN-LCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAW 145

  Fly   126 NNRCQG 131
            .:.|||
Mouse   146 RHHCQG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 47/121 (39%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844208
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.