DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and SPACA5B

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001073369.1 Gene:SPACA5B / 729201 HGNCID:19142 Length:159 Species:Homo sapiens


Alignment Length:138 Identity:52/138 - (37%)
Similarity:74/138 - (53%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WPIWLLVLLTLSLAT--GRQVGRCSLARQLYRYGM----AYNELPDWLCLVEGESSFNTKAINPS 60
            |...::.|.||.:.|  .:...||.||.:|.|.|:    .|. :.||||:...||.|:|..:: .
Human     4 WGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYG-VGDWLCMAHYESGFDTAFVD-H 66

  Fly    61 NVDGSVDWGLFQINDRYWCKPADG-RPSNDLCRLPCRLLLSDDIRYSIACAKYI-RKQQGFSAWV 123
            |.|||.::|:||:|..:||.  :| .|:.:||.:.|..||:..|...|.|||.| ..|.|.|||.
Human    67 NPDGSSEYGIFQLNSAWWCD--NGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWT 129

  Fly   124 AWNNRCQG 131
            :|...|.|
Human   130 SWRLHCSG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 47/120 (39%)
SPACA5BNP_001073369.1 LYZ_C 22..147 CDD:340383 47/120 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.