DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lyzl6

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:119 Identity:52/119 - (43%)
Similarity:65/119 - (54%) Gaps:6/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GRQVGRCSLARQLYRY---GMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVDWGLFQINDRYW 78
            |..:.|||||:.||..   |.....|||||||...||:||...:| .|||||.|:|:||||.|||
Mouse    19 GNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVN-ENVDGSFDYGIFQINSRYW 82

  Fly    79 CKPADGRPSNDLCRLPCRLLLSDDIRYSIACA-KYIRKQQGFSAWVAWNNRCQG 131
            |...... |.:.|.:.|:.|||.::..:|.|| |.:....|...||.|...|.|
Mouse    83 CNDYQSH-SENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHCLG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 51/118 (43%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 51/117 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844156
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 1 0.950 - 0 Normalized mean entropy S6989
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.