DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lyc2

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:134 Identity:61/134 - (45%)
Similarity:81/134 - (60%) Gaps:11/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVL--LTLSLATGRQVGR-CSLARQLYRYGMA-YN--ELPDWLCLVEGESSFNTKAINPSNVDG 64
            ||||  |.||.:...:|.: |.|||.|....:| |.  .|.:|:|:.:.||:|:|:|||.::.|.
  Rat     4 LLVLGFLLLSASVQAKVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEAINYNSTDQ 68

  Fly    65 SVDWGLFQINDRYWCKPADGRPSN--DLCRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAWN 126
            |.|:|:||||.||||.  ||:...  :.|.:||..||.|||..:|.||| .:|..||..|||||.
  Rat    69 STDYGIFQINSRYWCN--DGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQ 131

  Fly   127 NRCQ 130
            ..||
  Rat   132 RHCQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 54/120 (45%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 54/119 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347545
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.010

Return to query results.
Submit another query.