DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and lyz

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:143 Identity:47/143 - (32%)
Similarity:74/143 - (51%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSLATGRQVGRCSLARQLYRYGMAYNE---LPDWLCLVEGESSFNTKAINPSNVDGSVDW 68
            |.|..:|....:.:|||.:.:.....|:...|   :.:::|....||.|.|..:.  :.|...|:
Zfish     8 LCLAWMSSCESKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHRVR--SADTGKDY 70

  Fly    69 GLFQINDRYWCKPADGRP-SNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGV 132
            |:||||...||.  ||.| ..:||::.|..||:||::.|:.|||.|.|..|..:|..|::.|.|.
Zfish    71 GIFQINSFKWCD--DGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWETWDSYCNGR 133

  Fly   133 KPN--VNHCFRRR 143
            |.:  |..|.:|:
Zfish   134 KMSRWVKGCEQRK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 42/126 (33%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.