DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LYZL6

DIOPT Version :10

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_065159.1 Gene:LYZL6 / 57151 HGNCID:29614 Length:148 Species:Homo sapiens


Alignment Length:133 Identity:53/133 - (39%)
Similarity:67/133 - (50%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLT---LSLATGRQVGRCSLARQLYRY---GMAYNELPDWLCLVEGESSFNTKAINPSNVDG 64
            ||:.|.   |:|.....:.||.||:.|...   |.....|.|||||...||.||...|| .|.||
Human     5 LLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKIN-ENADG 68

  Fly    65 SVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAWNNR 128
            |.|:||||||..|||...... |.:||.:.|:.||:.::...|.||| .:...:|.:.||.|...
Human    69 SFDYGLFQINSHYWCNDYKSY-SENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLH 132

  Fly   129 CQG 131
            |.|
Human   133 CSG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ_C_invert 18..139 CDD:381618 48/118 (41%)
LYZL6NP_065159.1 LYZ_C 21..145 CDD:340383 48/117 (41%)

Return to query results.
Submit another query.