DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LALBA

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001371279.1 Gene:LALBA / 3906 HGNCID:6480 Length:142 Species:Homo sapiens


Alignment Length:132 Identity:44/132 - (33%)
Similarity:71/132 - (53%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PIWLL-VLLTLSLATGRQVGRCSLARQLYRY----GMAYNELPDWLCLVEGESSFNTKAINPSNV 62
            |::|: :|....||  :|..:|.|::.|...    |:|   ||:.:|.:...|.::|:||..:| 
Human     6 PLFLVGILFPAILA--KQFTKCELSQLLKDIDGYGGIA---LPELICTMFHTSGYDTQAIVENN- 64

  Fly    63 DGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNN 127
             .|.::|||||:::.|||.:....|.::|.:.|...|.|||...|.|||.|...:|...|:|...
Human    65 -ESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKA 128

  Fly   128 RC 129
            .|
Human   129 LC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 39/116 (34%)
LALBANP_001371279.1 Lys 20..138 CDD:395016 39/116 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.