DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LysS

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:142 Identity:63/142 - (44%)
Similarity:90/142 - (63%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWPIWLLVLLTLS--LATGRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPSNVD 63
            |...:.||||.::  ...||.:.||||||::...|:..::|..|.|:.:.||.:.|..:.|:|.|
  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSD 65

  Fly    64 GSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNR 128
            ||.|:|:|||||.|||: ||||.|.:.|.|.|..||:|||..|:.||:.:..|||:|||..| :.
  Fly    66 GSNDYGIFQINDLYWCQ-ADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW-HY 128

  Fly   129 CQGVKPNVNHCF 140
            |.|..|:::.||
  Fly   129 CSGWLPSIDECF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 55/120 (46%)
LysSNP_476829.1 LYZ1 20..140 CDD:197612 55/121 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468983
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1211.910

Return to query results.
Submit another query.