DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LysP

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster


Alignment Length:138 Identity:64/138 - (46%)
Similarity:92/138 - (66%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSLAT----GRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVD 67
            ||:..|:|..    .|.:.||||||::.:.|:..::|..|.|:.:.||||.|..:.|:|.:||.|
  Fly     5 LVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSND 69

  Fly    68 WGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGV 132
            :|:||||::|||||||||.|.:.|.|.|..||:|||..|:.||:.|::|||::||..| ..|.|.
  Fly    70 YGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW-KYCSGS 133

  Fly   133 KPNVNHCF 140
            .|::|.||
  Fly   134 LPSINSCF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 58/120 (48%)
LysPNP_476828.1 LYZ1 20..141 CDD:197612 58/121 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468985
Domainoid 1 1.000 109 1.000 Domainoid score I6334
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1211.910

Return to query results.
Submit another query.