DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LysB

DIOPT Version :10

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_523882.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster


Alignment Length:137 Identity:63/137 - (45%)
Similarity:89/137 - (64%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSLAT---GRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVDW 68
            :||:.|:||.   ||.:.||||||::...|:..::|..|.|:.|.|||:.|..:.|.|.:||.|:
  Fly     5 IVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDY 69

  Fly    69 GLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGVK 133
            |:|||||.|||.|..||.|.:.|.|.|..||:|||.:|:.||:.:..|||:|||..| :.|.|..
  Fly    70 GIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTW-HYCSGWL 133

  Fly   134 PNVNHCF 140
            |:::.||
  Fly   134 PSIDDCF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ_C_invert 18..139 CDD:381618 55/120 (46%)
LysBNP_523882.1 LYZ_C_invert 19..139 CDD:381618 55/120 (46%)

Return to query results.
Submit another query.