DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and LysB

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster


Alignment Length:137 Identity:63/137 - (45%)
Similarity:89/137 - (64%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSLAT---GRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVDW 68
            :||:.|:||.   ||.:.||||||::...|:..::|..|.|:.|.|||:.|..:.|.|.:||.|:
  Fly     5 IVLVALALAAPALGRTMDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYNGSNDY 69

  Fly    69 GLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGVK 133
            |:|||||.|||.|..||.|.:.|.|.|..||:|||.:|:.||:.:..|||:|||..| :.|.|..
  Fly    70 GIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTW-HYCSGWL 133

  Fly   134 PNVNHCF 140
            |:::.||
  Fly   134 PSIDDCF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 55/120 (46%)
LysBNP_001261245.1 Lys 19..139 CDD:278491 55/120 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468987
Domainoid 1 1.000 109 1.000 Domainoid score I6334
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1211.910

Return to query results.
Submit another query.