DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and CG11159

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster


Alignment Length:135 Identity:50/135 - (37%)
Similarity:76/135 - (56%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLTLSLATGRQVGRCSLARQLYRYGMAYNELPDWLCLVEGESSFNT-KAINPSNVDGSVDWGL 70
            |:||:......:.:.||.||::|.|:....:.|.:|:||||.||..:| |::...|  .||.:||
  Fly    17 LLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAESGRSTSKSMQLPN--QSVSYGL 79

  Fly    71 FQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQG-VKP 134
            ||||.:.||:  .|| ...:|.:.|...|:|:|.....||..|..:.||.||..|.::|:| ..|
  Fly    80 FQINSKNWCR--KGR-RGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWMSKCRGRTLP 141

  Fly   135 NVNHC 139
            :|:.|
  Fly   142 DVSRC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 46/122 (38%)
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 46/122 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458908
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.