DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and CG16799

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:143 Identity:46/143 - (32%)
Similarity:78/143 - (54%) Gaps:13/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWPIWLLVLLTLSL--ATGRQVGRCSLARQL---YRYGMAYNELPDWLCLVEGESSFNTKAINPS 60
            :|.:.:|:||.|.:  ...::..||.|.|.|   |.:...:  :.:|:||||.||..:|..:...
  Fly    22 LWIVPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTF--ISNWICLVEHESYLDTTKVTKK 84

  Fly    61 NVDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAW 125
            . :.|.::||||||.:.:|  ::||.... |.:.|....:|||...||||:.|::::||..|..|
  Fly    85 G-NESKNYGLFQINSKDYC--SEGRKGGQ-CNMKCEDFSNDDISDDIACARMIQEREGFKYWKGW 145

  Fly   126 NNRCQGVK--PNV 136
            :..|:..:  ||:
  Fly   146 DRFCRNPQNLPNL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 41/124 (33%)
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 41/124 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458909
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
65.850

Return to query results.
Submit another query.