DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lyzl1

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001102352.1 Gene:Lyzl1 / 364745 RGDID:1559869 Length:148 Species:Rattus norvegicus


Alignment Length:131 Identity:45/131 - (34%)
Similarity:67/131 - (51%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IWLLVLLTLSLATGRQVGRCSLARQLYRYGM-AYN--ELPDWLCLVEGESSFNTKAINPSNVDGS 65
            ::.|::....:|..:...||.||:...:.|: .|.  .|.:|||:...||.:||.|..... |||
  Rat     6 VFALIMSLGIVAESKVYTRCKLAKVFVKAGLDNYGGFTLGNWLCMAYYESHYNTSAETVLE-DGS 69

  Fly    66 VDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQ-QGFSAWVAWNNRC 129
            .|:|:||||...||:.......|. |.:.|..|.:||:..:|.|||.|.|: ||.:.|..|...|
  Rat    70 TDYGIFQINSFTWCRNGKKHQKNH-CHVACSALTTDDLTDAILCAKKIVKETQGMNYWQGWKKNC 133

  Fly   130 Q 130
            :
  Rat   134 E 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 43/117 (37%)
Lyzl1NP_001102352.1 LYZ1 20..143 CDD:238066 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.