DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and RGD1306474

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001102216.1 Gene:RGD1306474 / 362881 RGDID:1306474 Length:151 Species:Rattus norvegicus


Alignment Length:135 Identity:52/135 - (38%)
Similarity:79/135 - (58%) Gaps:10/135 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLTLSL------ATGRQVGRCSLARQLYRYGMAYNE---LPDWLCLVEGESSFNTKAINPSN 61
            |..||||.|      ..|:.:.||.|||.|.|:|:...:   |.:|:||.:..|.::||||..::
  Rat     4 LPTLLTLGLLLLSITVQGKVLNRCLLARTLQRFGLGGFKGISLANWICLAKSVSGYDTKAIKYNH 68

  Fly    62 VDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQ-QGFSAWVAW 125
            .|.|.::|:|||:.||||..:....|.:.||:.|:.||.::|:.|:.|||.|.|. :|.:.|.||
  Rat    69 EDRSTNYGIFQISSRYWCNDSKTPGSKNFCRVSCKALLKNNIKASVTCAKRIVKDPRGITTWEAW 133

  Fly   126 NNRCQ 130
            ...|:
  Rat   134 RKNCE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 45/117 (38%)
RGD1306474NP_001102216.1 LYZ1 22..149 CDD:197612 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347544
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.