DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and CG16756

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster


Alignment Length:134 Identity:47/134 - (35%)
Similarity:77/134 - (57%) Gaps:8/134 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLTLSLATGRQVGRCSLARQLY-RYGMAYNELPDWLCLVEGESSFNTKAINPSNVDGSVDWG 69
            ||:.:...:.:.::..||.|||:|. ::|...:.|.:|:||:|.||..:|..|. :|.:||.::|
  Fly    18 LLLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRIT-TNANGSRNYG 81

  Fly    70 LFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAKYIRKQQGFSAWVAWNNRCQGVK- 133
            |||||.|: |:  :|| ...:|...|...|.:::|.|:.|||.|:...||..|..|...|:..: 
  Fly    82 LFQINGRF-CQ--EGR-RGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYCRNAQN 142

  Fly   134 -PNV 136
             ||:
  Fly   143 LPNL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 45/122 (37%)
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 43/119 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.