DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Spaca5

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001101528.1 Gene:Spaca5 / 314431 RGDID:1584964 Length:160 Species:Rattus norvegicus


Alignment Length:134 Identity:49/134 - (36%)
Similarity:74/134 - (55%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLTLSLAT--GRQVGRCSLARQLYRYGM----AYNELPDWLCLVEGESSFNTKAINPSNVDG 64
            :::|.||.|||  .:...||.|||:|.:.|:    .|. :.||||:...||.|:|..:: .|.||
  Rat     8 VVILATLLLATVDAKIYERCELARKLEKAGLNGFKGYT-VGDWLCVAHYESGFDTSFVD-HNPDG 70

  Fly    65 SVDWGLFQINDRYWCKPADG-RPSNDLCRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAWNN 127
            |.::|:||:|..:||.  :| .|:.:||.:.|..||:..|...|.||| .:...:...||.:|..
  Rat    71 SSEYGIFQLNSAWWCN--NGITPTQNLCHMDCNDLLNRHILDDIMCAKRVVSSHKSMKAWDSWTR 133

  Fly   128 RCQG 131
            .|.|
  Rat   134 HCAG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 43/120 (36%)
Spaca5NP_001101528.1 LYZ_C 22..147 CDD:340383 43/120 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.