DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Spaca3

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:137 Identity:56/137 - (40%)
Similarity:80/137 - (58%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLV--LLTLSLATGRQ--VGRCSLARQLYRYGM----AYNELPDWLCLVEGESSFNTKAINPSN 61
            ||.:  ||:..||:.:.  ..||.||:.|:.:|:    .|| |.||:||....|.|||.|:: ..
  Rat    19 WLALAYLLSCLLASSKAKVFSRCELAKVLHDFGLEGYRGYN-LADWICLAYYTSGFNTDAVD-HE 81

  Fly    62 VDGSVDWGLFQINDRYWCKP-ADGRPSNDLCRLPCRLLLSDDIRYSIACA-KYIRKQQGFSAWVA 124
            .|||.:.|:|||:.|.|||. |...|  :|||:.|..|||:|::.|:||. |..::.||...|.:
  Rat    82 ADGSTNNGIFQISSRKWCKNLAPNGP--NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWES 144

  Fly   125 WNNRCQG 131
            |.:.|||
  Rat   145 WKHHCQG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 50/122 (41%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 50/120 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.