DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Spaca5

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:132 Identity:44/132 - (33%)
Similarity:70/132 - (53%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLTLSLATGRQVGRCSLARQLYRYGM----AYNELPDWLCLVEGESSFNTKAINPSNVDGSV 66
            :|.:|.::....:...||.||::|...|:    .|. :.||||:...||.|:|..:: .|.|||.
Mouse    10 ILAVLLIAKLDAKIYERCELAKKLEEAGLDGFKGYT-VGDWLCVAHYESGFDTSFVD-HNPDGSS 72

  Fly    67 DWGLFQINDRYWCKPADG-RPSNDLCRLPCRLLLSDDIRYSIACAKYI-RKQQGFSAWVAWNNRC 129
            ::|:||:|..:||.  :| .|:.:||.:.|..||:..|...|.|||.: ...:...||.:|...|
Mouse    73 EYGIFQLNSAWWCN--NGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHC 135

  Fly   130 QG 131
            .|
Mouse   136 AG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 42/120 (35%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844216
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.