DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lyz2

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:176 Identity:60/176 - (34%)
Similarity:76/176 - (43%) Gaps:51/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLVLLTLSLATGRQV---GRCSLARQLYRYGMA--YN-ELPDWLCLVEGESSFNTKAINPSNVDG 64
            ||||..|.|:...|.   .||..||.|.|.||:  |. .|.||:||.:.||::||:|.|.:..|.
  Rat     4 LLVLGFLLLSASVQAKTYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQARNYNPGDQ 68

  Fly    65 SVDWGLFQINDRYWCKPADGRPSNDLCRLPCRL-------------------------------- 97
            |.|:|:||||.||||.......:.:.|.:||..                                
  Rat    69 STDYGIFQINSRYWCNDGKTPRAKNACGIPCSAVVTEKSSKHQQRRDILSLGTASIHLSGSLWET 133

  Fly    98 ------------LLSDDIRYSIACAK-YIRKQQGFSAWVAWNNRCQ 130
                        ||.|||..:|.||| .:|..||..|||||...|:
  Rat   134 LLRNVNPAVHTSLLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 54/164 (33%)
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 53/161 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347546
Domainoid 1 1.000 106 1.000 Domainoid score I6429
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4799
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8912
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.