DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lalba

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_036726.1 Gene:Lalba / 24528 RGDID:2987 Length:159 Species:Rattus norvegicus


Alignment Length:91 Identity:32/91 - (35%)
Similarity:52/91 - (57%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LPDWLCLVEGESSFNTKAINPSNVDGSVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDI 103
            |.:|.|::...|.::::||..:|  ||.::|||||::|.|||.::...|.::|.:.|...|.|::
  Rat    42 LLEWTCVLFHTSGYDSQAIVKNN--GSTEYGLFQISNRNWCKSSEFPESENICDISCDKFLDDEL 104

  Fly   104 RYSIACAKYIRKQQGFSAWVAWNNRC 129
            ...|.|||.|...:|...|.|....|
  Rat   105 ADDIVCAKKIVAIKGIDYWKAHKPMC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 32/91 (35%)
LalbaNP_036726.1 Lys 20..137 CDD:395016 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.