DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7798 and Lyz1

DIOPT Version :9

Sequence 1:NP_611098.1 Gene:CG7798 / 36798 FlyBaseID:FBgn0034092 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_038618.1 Gene:Lyz1 / 17110 MGIID:96902 Length:148 Species:Mus musculus


Alignment Length:150 Identity:65/150 - (43%)
Similarity:81/150 - (54%) Gaps:16/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLTLSL------ATGRQVGRCSLARQLYRYGM-AYN--ELPDWLCLVEGESSFNTKAINPSNVDG 64
            ||||.|      |..:...||.|||.|.|.|| .|.  :|.||:||.:.||::||:|.|.:..|.
Mouse     4 LLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDR 68

  Fly    65 SVDWGLFQINDRYWCKPADGRPSNDLCRLPCRLLLSDDIRYSIACAK-YIRKQQGFSAWVAWNNR 128
            |.|:|:||||.||||.......|.:.|.:.|..||.|||..:|.||| .:|..||..|||||..:
Mouse    69 STDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQ 133

  Fly   129 CQGVKPNVNHCFRRRHRNSG 148
            ||      |....:..||.|
Mouse   134 CQ------NRDLSQYIRNCG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7798NP_611098.1 LYZ1 18..139 CDD:238066 56/124 (45%)
Lyz1NP_038618.1 LYZ1 19..147 CDD:197612 58/133 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844182
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.